PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.15822s0012.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family Trihelix
Protein Properties Length: 389aa    MW: 44323.9 Da    PI: 8.1151
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.15822s0012.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix85.28e-27293374185
              trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdql 85 
                           rW+++ev+aLi ar+++e++++ +  k+  W+e+s++m+erg+ers+k+Ckekwen+nk+y+++ eg +k+ +e+s+t +yf++l
  Cagra.15822s0012.1.p 293 RWPQEEVQALISARSYVEDKSGIN--KGSIWDEISARMKERGYERSAKKCKEKWENMNKYYRRVMEGGRKQ-PEHSKTRSYFEKL 374
                           8*******************9998..99*****************************************95.9**********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.003290350IPR001005SANT/Myb domain
SuperFamilySSF466891.23E-5291371IPR009057Homeodomain-like
PfamPF138372.3E-20292374No hitNo description
CDDcd122031.89E-22292354No hitNo description
Gene3DG3DSA:1.10.10.605.7E-5292348IPR009057Homeodomain-like
PROSITE profilePS500907.561293348IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MELLAGDCRK RVGDDFSEDV DPFDGSDGGC GWMYGSRESG SHGNDDALAT LADLASPPQK  60
LKPIRCGVKP PSSSSEDRHP LDILAGTLDR LPEMGFGCFD TPLGSKIADV EQSGQLTRGF  120
SKGDDPLPLH IEFQARNRLS WDGVSLSSSV DSDSDSSPDV GKTVTGKRKR KTRVKLEHFL  180
EKLVGIMMKR QEKMHNQLIK VMEKMEGERI RREEAWRQQE IERMKQNEEA RKQEMARSLS  240
LISFIRSVIG DEIEIPKPSE FPQPLQQILP EKCESAQTQR ERTFRYSRSG GRRWPQEEVQ  300
ALISARSYVE DKSGINKGSI WDEISARMKE RGYERSAKKC KEKWENMNKY YRRVMEGGRK  360
QPEHSKTRSY FEKLGDFYKT NSSGEREE*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00552DAPTransfer from AT5G47660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0256281e-141AB025628.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MNJ7.
GenBankCP0026881e-141CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006279804.10.0hypothetical protein CARUB_v10027995mg
TrEMBLR0EUC70.0R0EUC7_9BRAS; Uncharacterized protein
STRINGAl_scaffold_0008_210.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM94112736
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47660.10.0Trihelix family protein